DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and rnf38

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:XP_021331935.1 Gene:rnf38 / 566820 ZFINID:ZDB-GENE-030131-8693 Length:676 Species:Danio rerio


Alignment Length:93 Identity:29/93 - (31%)
Similarity:50/93 - (53%) Gaps:4/93 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 MLNQMETSG---PPPLSAQRINEIPNVQIN-AEEVNRKIQCSICWDDFKIDETVRKLPCSHLYHE 277
            :||..|..|   |..|:...|.::|:.:.| :...:.:..|.:|..||:..:.:|.|||:|.:|.
Zfish   584 LLNLAERLGEAKPRGLTKADIEQLPSYRFNPSNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHA 648

  Fly   278 NCIVPWLNLHSTCPICRKSLADDGNDAD 305
            .|:..||..:.||||||...::...|::
Zfish   649 KCVDKWLKANRTCPICRADASEVQRDSE 676

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030
RING-H2_RNF126_like 252..294 CDD:319581 17/41 (41%)
HRD1 <253..372 CDD:227568 20/53 (38%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 16/39 (41%)
rnf38XP_021331935.1 RING-H2_RNF38_like 621..665 CDD:319386 17/43 (40%)
RING-H2 finger (C3H2C3-type) 624..664 CDD:319386 16/39 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.