DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and pja2

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:XP_009300150.1 Gene:pja2 / 565118 ZFINID:ZDB-GENE-060526-337 Length:661 Species:Danio rerio


Alignment Length:129 Identity:35/129 - (27%)
Similarity:59/129 - (45%) Gaps:33/129 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 PPLSAQRINEIPNVQINAEEVNRKIQCSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHSTCP 291
            ||.:.|.|:.:|.:.::||.:.::..|:||..::..||....|||.|::|:.|:..||....|||
Zfish   562 PPATEQIIDCLPQITMHAENIEQEQCCAICCCEYVKDEIATLLPCRHMFHKLCVTLWLRKSGTCP 626

  Fly   292 ICRKSLADDGNDADDEFVMLDAFGPEMAADGS--NSERRSASTATGTDNPSPANNPSQAAAEGG 353
            :||..|.                 |.:..|.:  :||:.:              :||..:|.||
Zfish   627 VCRHVLT-----------------PAVTTDPASLSSEQET--------------SPSTHSASGG 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030
RING-H2_RNF126_like 252..294 CDD:319581 16/41 (39%)
HRD1 <253..372 CDD:227568 28/103 (27%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 16/39 (41%)
pja2XP_009300150.1 zf-RING_2 588..629 CDD:290367 16/40 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.