DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and rlim

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:XP_009306042.1 Gene:rlim / 562487 ZFINID:ZDB-GENE-120809-2 Length:638 Species:Danio rerio


Alignment Length:323 Identity:84/323 - (26%)
Similarity:121/323 - (37%) Gaps:82/323 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GFVEELPANAPEMDSST--AGASG-------------SARSGSSGSGSSGSHDTLSRGSSSSGSQ 90
            |...::|....|.:::|  |||||             ..|.|......|.::.|.|| |.:|.:.
Zfish   322 GSATDVPEAPQEREATTGEAGASGRRPPTIMLDLQVRRVRPGEYRQRDSIANRTRSR-SQTSNNT 385

  Fly    91 VNVESLRNDI---VSLLNMRNVPNLEITIE-PNRRHSNVLHLGGFGGPSGSDSARGLTAGGRVRP 151
            :..|:.|...   .|......|.....||. |.||.|:          :|...|..|.....:|.
Zfish   386 LLYETERGGFRRTFSRSERAGVRTYVSTIRIPIRRISD----------AGLGEATSLALQSMIRQ 440

  Fly   152 ----------------ANLDRLDNVLFDFLQSLPLAGATAEIVTG--------PGGGGVGGGG-- 190
                            .:.:|.||...|.  |..|....|...||        ||.||:..||  
Zfish   441 IMTGFGELSYFMEAEVPDSNREDNPPADL--SDALGNPDASTGTGASEADPYLPGHGGLNQGGLE 503

  Fly   191 ---NSHMFFMGNPGDYAWGRE---------GLDTIVTQ---------MLNQMETSGPPPLSAQRI 234
               .......|.|| .|..||         .||...:.         :||:.:...|..|:.::|
Zfish   504 ARTEEREVEGGLPG-AAGPRENRGRQRAPINLDETGSLPFLRLAHFFLLNEEDDDQPRGLTKEQI 567

  Fly   235 NEIPNVQINAEEVNRKIQCSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHSTCPICRKSL 297
            :.:.  ..|..|.:....||:|..::.....:|||||||.||.:||..||:.:|||||||:::
Zfish   568 DNLS--MRNFGESDAFKTCSVCITEYAEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAV 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030 1/4 (25%)
RING-H2_RNF126_like 252..294 CDD:319581 21/41 (51%)
HRD1 <253..372 CDD:227568 23/45 (51%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 20/39 (51%)
rlimXP_009306042.1 zf-RING_2 583..625 CDD:290367 21/41 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.