DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and rnf130

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:XP_009289393.1 Gene:rnf130 / 553950 ZFINID:ZDB-GENE-050522-525 Length:428 Species:Danio rerio


Alignment Length:88 Identity:27/88 - (30%)
Similarity:44/88 - (50%) Gaps:21/88 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 CSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHSTCPICRKSLADDGNDADDEFVMLDAFG-- 315
            |::|.:.:::::.||.|||.|::|:.|:.||||.|.|||:|:.::             |.|.|  
Zfish   273 CAVCIEGYQLNDVVRILPCKHVFHKMCVDPWLNEHCTCPMCKLNI-------------LKALGVM 324

  Fly   316 ------PEMAADGSNSERRSAST 332
                  ..||.|.....|...|:
Zfish   325 PNLPCVDNMAFDMDRMSRSQTSS 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030
RING-H2_RNF126_like 252..294 CDD:319581 18/40 (45%)
HRD1 <253..372 CDD:227568 27/88 (31%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 18/39 (46%)
rnf130XP_009289393.1 PA_GRAIL_like 49..188 CDD:239037
zf-RING_2 271..314 CDD:290367 18/40 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.