DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and rnf181

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_001011200.1 Gene:rnf181 / 496625 XenbaseID:XB-GENE-964051 Length:156 Species:Xenopus tropicalis


Alignment Length:103 Identity:35/103 - (33%)
Similarity:54/103 - (52%) Gaps:14/103 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 PPPLSAQRINEIPNVQINAEEVNRKIQCSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHSTC 290
            |||.:.:.:..:|.|.:..|:.:..::|.:|..:|:..||||:|||.||:|.:||:|||...::|
 Frog    52 PPPAAKKVVESLPKVTVTPEQADAALKCPVCLLEFEEGETVRQLPCEHLFHSSCILPWLGKTNSC 116

  Fly   291 PICRKSLADDGNDADDEFVMLDAFGPEMAADGSNSERR 328
            |:||..|..|              .||........|||
 Frog   117 PLCRHELPTD--------------SPEYEEYKQEKERR 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030
RING-H2_RNF126_like 252..294 CDD:319581 20/41 (49%)
HRD1 <253..372 CDD:227568 29/76 (38%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 20/39 (51%)
rnf181NP_001011200.1 PEX10 <10..126 CDD:227861 29/73 (40%)
RING-H2_RNF181 78..123 CDD:319583 22/44 (50%)
RING-H2 finger (C3H2C3-type) 79..119 CDD:319583 20/39 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.