DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and RNF165

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_689683.2 Gene:RNF165 / 494470 HGNCID:31696 Length:346 Species:Homo sapiens


Alignment Length:50 Identity:22/50 - (44%)
Similarity:31/50 - (62%) Gaps:0/50 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 EEVNRKIQCSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHSTCPICR 294
            ||.:...:|:||....:..|.||:|||.||:|:.|:..||.:...|||||
Human   286 EESDTDEKCTICLSMLEDGEDVRRLPCMHLFHQLCVDQWLAMSKKCPICR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030
RING-H2_RNF126_like 252..294 CDD:319581 18/41 (44%)
HRD1 <253..372 CDD:227568 19/41 (46%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 17/39 (44%)
RNF165NP_689683.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..76
Ubiquitin binding. /evidence=ECO:0000269|PubMed:26656854, ECO:0007744|PDB:5D0K 266..268
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 267..288 1/1 (100%)
RING-H2_RNF111_like 292..337 CDD:319388 19/43 (44%)
Ubiquitin binding. /evidence=ECO:0000269|PubMed:26656854, ECO:0007744|PDB:5D0K 309..313 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.