DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and CG14983

DIOPT Version :10

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_647843.1 Gene:CG14983 / 38466 FlyBaseID:FBgn0035479 Length:163 Species:Drosophila melanogaster


Alignment Length:47 Identity:17/47 - (36%)
Similarity:23/47 - (48%) Gaps:6/47 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 CSICWDDFKID----ETVRKLPCSHLYHENCIVPWLNLHSTCPICRK 295
            ||||  |.|.:    .::..|.|.||:..:||...|...|.||.|.:
  Fly   101 CSIC--DLKCEPHGRHSMVSLRCGHLFGRHCINNVLRESSRCPTCSR 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:433910
RING-H2_RNF126-like 252..294 CDD:438329 16/44 (36%)
HRD1 <253..372 CDD:227568 17/47 (36%)
CG14983NP_647843.1 RING_Ubox 99..156 CDD:473075 17/47 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.