DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and Rnf43

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:XP_006247152.1 Gene:Rnf43 / 303412 RGDID:1305204 Length:802 Species:Rattus norvegicus


Alignment Length:343 Identity:72/343 - (20%)
Similarity:117/343 - (34%) Gaps:115/343 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LLNMRNVPNLE------ITIEPNRRHSNVLHLGGFGGPSGSDSARGLTAGGRVRPANLDRLDNVL 161
            |.|..:..|||      :.:|..||...         |..|.:::...||.|...|       ||
  Rat    90 LCNASDDDNLEPGFISIVKLESPRRAPR---------PCLSLASKARMAGERGASA-------VL 138

  Fly   162 FDFLQSLPLA-------GATAEIVTGPGGGGVGGGGNSHM--FFMGNPGDY---------AWGRE 208
            ||..:....|       |.|..:|.      :.|.....:  |...|...|         ||...
  Rat   139 FDITEDRSAAEQLQQPLGLTKPVVL------IWGSDAEKLMEFVYKNRKAYVWIELKEPPAWANY 197

  Fly   209 GLDTIVT--------------QMLNQMETSGPPPL---SAQRINEIPNVQINAEEVNRKIQ---- 252
            .:..::|              ::..:...|.|.||   :|:.|:::...:..|.....:.:    
  Rat   198 DVWILLTVVGTVFVIILASVLRIRCRPHPSRPDPLQQRTARAISQLATRRYQASCRRARAEWPDS 262

  Fly   253 ---------CSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHSTCPICRKSLADDGNDADDEF 308
                     |:||.::|...:.:|.:.|.|.:|..|:.|||:.|.|||:|..::.:.        
  Rat   263 GSSSSSAPVCAICLEEFTEGQELRVISCLHEFHRTCVDPWLHQHRTCPLCMFNIVEG-------- 319

  Fly   309 VMLDAFGPEMAADGSNSE--RR-----------------------SASTATGTDNPSPANNPSQA 348
               |:|...:.|..|..|  ||                       |.::...|..|.|. .|||.
  Rat   320 ---DSFSQALGASPSYQEPGRRLHLIRQHPGHAHYHLPSAYLLGPSRNSVAQTPRPRPF-LPSQE 380

  Fly   349 AAEGGRTR--PDANPAQA 364
            .:.|.|.:  |.|:..:|
  Rat   381 PSMGSRHQRLPRASHLRA 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030
RING-H2_RNF126_like 252..294 CDD:319581 16/54 (30%)
HRD1 <253..372 CDD:227568 36/139 (26%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 16/39 (41%)
Rnf43XP_006247152.1 ZNRF_3_ecto 85..187 CDD:408039 26/118 (22%)
RING-H2_RNF43 270..316 CDD:319712 17/45 (38%)
dnaA 598..>743 CDD:237605
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.