DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and AT4G24015

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_974604.1 Gene:AT4G24015 / 2745724 AraportID:AT4G24015 Length:174 Species:Arabidopsis thaliana


Alignment Length:114 Identity:34/114 - (29%)
Similarity:53/114 - (46%) Gaps:31/114 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 SGPPPL------SAQRINEIPNVQI----------------NAEEVNRKIQCSICWDDFKIDETV 266
            |.|.|:      |.|..:.:|:|.:                |.|...|...|.:|..:|::.|.:
plant    54 SSPSPMILPVSSSHQTSSHLPSVCLLDVKVELKDKLHVVLFNEELGTRDSLCCVCLGEFELKEEL 118

  Fly   267 RKLP-CSHLYHENCIVPWLNLHSTCPICRKSLA--------DDGNDADD 306
            .::| |.|::|.:||..||..|:|||:||.|::        ||.||..|
plant   119 VEMPLCKHIFHLDCIHLWLYSHNTCPLCRSSVSISSTKTSVDDDNDHPD 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030
RING-H2_RNF126_like 252..294 CDD:319581 16/42 (38%)
HRD1 <253..372 CDD:227568 24/63 (38%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 16/40 (40%)
AT4G24015NP_974604.1 HRD1 <87..>174 CDD:227568 27/81 (33%)
RING_Ubox 105..147 CDD:418438 16/41 (39%)
RING-H2 finger (C3H2C3-type) 105..146 CDD:319361 16/40 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.