powered by:
Protein Alignment Iru and RNF11
DIOPT Version :9
Sequence 1: | NP_649859.1 |
Gene: | Iru / 41080 |
FlyBaseID: | FBgn0037653 |
Length: | 380 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_055187.1 |
Gene: | RNF11 / 26994 |
HGNCID: | 10056 |
Length: | 154 |
Species: | Homo sapiens |
Alignment Length: | 69 |
Identity: | 28/69 - (40%) |
Similarity: | 36/69 - (52%) |
Gaps: | 6/69 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 231 AQRINEIPNVQINAEEVNR-----KI-QCSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHST 289
||||..|.::.....:..| || :|.||..||...:.:|.|||.|:||.:||..||....|
Human 71 AQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFT 135
Fly 290 CPIC 293
||.|
Human 136 CPSC 139
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.