DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and 4930595M18Rik

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_775611.2 Gene:4930595M18Rik / 245492 MGIID:3045300 Length:829 Species:Mus musculus


Alignment Length:294 Identity:73/294 - (24%)
Similarity:113/294 - (38%) Gaps:63/294 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 NVEINIPNSDFTCPLCANGF--VEELPANAPEMDSSTAGASGSARSGSSGSGSSGSHDTLSRGSS 85
            |:|..||::  .|....|..  |.|:..|..|.|..:..:..|..:....||    |..:||..|
Mouse   591 NLECTIPSA--PCETSGNIMLGVFEVDDNFTEFDLQSCDSLSSQNNRRVHSG----HSRISRSVS 649

  Fly    86 SSGSQVNVESLRNDIVSLLNMRNVPNLEITIEPNRRHSNVLHLGGFGGPSGSDSARGLTAGGRVR 150
            |..|.....|..|.  |||::.|.....:.:.                 |.||:    ..|..:.
Mouse   650 SLNSNSTTSSSTNH--SLLSLLNYSQQFLPVS-----------------STSDN----IIGNDIN 691

  Fly   151 PANLDRLDNVLFDFL--QSLPLAGATAEIVTGPGGGGVGGGGNSHMFFMGNPGDYAWGREGLDTI 213
            ..:..:::....:|:  ...|........||.|.              ..|..|| |      .:
Mouse   692 LPHTSQINQESNEFIVFNCPPFEARQQMHVTSPE--------------TSNDSDY-W------PV 735

  Fly   214 VTQM--LNQMETSGPPPLSAQRINEIPNVQI-NAEEVNRKIQCSICWDDFKIDETVRKLPCSHLY 275
            :...  .|.:..:.|..|:.::||.:|.:.. ..:|::   .||||...:..:..:|.|||.|.|
Mouse   736 LPDFSNFNDIHNNHPKGLTEEQINNLPVIYFCENDEIS---HCSICLTQYIKNSKIRVLPCFHEY 797

  Fly   276 HENCIVPWLNLHSTCPICRKSLADDGNDADDEFV 309
            |:.||..||:.:||||||||.:.   |..|.||:
Mouse   798 HDKCIDRWLSDNSTCPICRKHII---NSDDTEFL 828

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030 7/24 (29%)
RING-H2_RNF126_like 252..294 CDD:319581 20/41 (49%)
HRD1 <253..372 CDD:227568 27/57 (47%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 19/39 (49%)
4930595M18RikNP_775611.2 RRM <14..176 CDD:223796
RRM_SF 16..88 CDD:302621
zf-RING_2 775..816 CDD:290367 20/40 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.