DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and RNF215

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_001017981.1 Gene:RNF215 / 200312 HGNCID:33434 Length:377 Species:Homo sapiens


Alignment Length:344 Identity:75/344 - (21%)
Similarity:120/344 - (34%) Gaps:101/344 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 AGASGSARSGSSGSGSSGS---------HDTLSRGSSSSGSQVNVESLRNDIVSLLNMRNVPNLE 113
            |.|.||..:..:|.|.:.:         .|.|.......||:.:...|....:.|:::.:... |
Human    41 AAADGSEPAAGAGRGGARAVRVDVRLPRQDALVLEGVRIGSEADPAPLLGGRLLLMDIVDAEQ-E 104

  Fly   114 ITIE-------PNRRHSNVLHLGGFG-GPSGSDSA------RGLTAGGR-----------VRPAN 153
            ..:|       ..:..:...|....| ||.....|      |.|..|..           ||..:
Human   105 APVEGWIAVAYVGKEQAAQFHQENKGSGPQAYPKALVQQMRRALFLGASALLLLILNHNVVRELD 169

  Fly   154 LDRL-----------DNV--LFDFLQSLPLAGATAEIVTGP----------------GGGGVGGG 189
            :.:|           .||  |.|.|  |....|||||.:|.                |....|.|
Human   170 ISQLLLRPVIVLHYSSNVTKLLDAL--LQRTQATAEITSGESLSANIEWKLTLWTTCGLSKDGYG 232

  Fly   190 GNSHMFFMGNPGDYAWGREGLDTIVTQML---------------------NQMETSGPPPLSAQR 233
            |...:..:|  |..|..::.|..:...:|                     :|.|..|...|..:|
Human   233 GWQDLVCLG--GSRAQEQKPLQQLWNAILLVAMLLCTGLVVQAQRQASRQSQRELGGQVDLFKRR 295

  Fly   234 -INEIPNVQINAEEVNRKIQ---------CSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHS 288
             :..:.:::.....::|..|         |::|.|.|...:.:|.|||.|.:|.:|:.|||.|..
Human   296 VVRRLASLKTRRCRLSRAAQGLPDPGAETCAVCLDYFCNKQWLRVLPCKHEFHRDCVDPWLMLQQ 360

  Fly   289 TCPICRKSLADDGNDADDE 307
            |||:|:.::.  ||...|:
Human   361 TCPLCKFNVL--GNRYSDD 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030
RING-H2_RNF126_like 252..294 CDD:319581 19/50 (38%)
HRD1 <253..372 CDD:227568 22/55 (40%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 18/39 (46%)
RNF215NP_001017981.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
zf-RING_2 323..366 CDD:290367 18/42 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.