DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and PRE1

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_010928.1 Gene:PRE1 / 856731 SGDID:S000000814 Length:198 Species:Saccharomyces cerevisiae


Alignment Length:204 Identity:42/204 - (20%)
Similarity:81/204 - (39%) Gaps:33/204 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VVAMRGKDCVAIATDHRF--GIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRKNL 73
            ::.:|.:|.|.:|:....  ||.....|.|  |...:.|...:...|...|.:...:.:.....|
Yeast     4 ILGIRVQDSVILASSKAVTRGISVLKDSDD--KTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQL 66

  Fly    74 YETRENREMCPKPFSAM----MSSFLYEHRFGPYFIEPVVAGLDPKTMEPFICNMDLIGCPNAPD 134
            |..||:.|:.|:..|:.    ::..:...|  ||.:..::.|.|.|..:|.:..:|.:       
Yeast    67 YSIREDYELSPQAVSSFVRQELAKSIRSRR--PYQVNVLIGGYDKKKNKPELYQIDYL------- 122

  Fly   135 DFVVAGTCAEQLYG-----------MCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVY 188
                 ||..|..||           :.:..::||:..::..:::...:.....|..|...|..|.
Yeast   123 -----GTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVIVK 182

  Fly   189 IIEKDKITE 197
            |::||.|.:
Yeast   183 IVDKDGIRQ 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 42/204 (21%)
PRE1NP_010928.1 proteasome_beta_type_2 1..194 CDD:239727 42/204 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.