DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and PRE9

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_011651.3 Gene:PRE9 / 853036 SGDID:S000003367 Length:258 Species:Saccharomyces cerevisiae


Alignment Length:190 Identity:33/190 - (17%)
Similarity:71/190 - (37%) Gaps:28/190 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NGGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTD--ILTVRDRLMF 69
            :.|..:.:...|.:.:|.:.:.........|..:|::.:..::.:.:.||..|  ||....|:..
Yeast    31 HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARIHA 95

  Fly    70 RKNLYETREN--REMCPKPFSAMMSSFLYEHRFGPYFIEPVVAGLDPKTMEPFICNMDLIG---- 128
            :..|....|:  .|:..:..|.:...:.......|:.:..:.||.|           |..|    
Yeast    96 QNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYD-----------DRYGYQLY 149

  Fly   129 CPNAPDDF-------VVAGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMS 181
            ..|...::       |.|.|.|.|.  :.:..:|.|::.|...|:..:::....|..|::
Yeast   150 TSNPSGNYTGWKAISVGANTSAAQT--LLQMDYKDDMKVDDAIELALKTLSKTTDSSALT 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 33/190 (17%)
PRE9NP_011651.3 proteasome_alpha_type_4 4..216 CDD:239721 33/190 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.