DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and PRE7

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_009512.1 Gene:PRE7 / 852239 SGDID:S000000137 Length:241 Species:Saccharomyces cerevisiae


Alignment Length:222 Identity:47/222 - (21%)
Similarity:94/222 - (42%) Gaps:30/222 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NGGCVVAMRGKDCVAIATDHRFGIQAQTISTDFK-KVFHIGPRMFLGLTGLQTDILTVRDRLMFR 70
            |||.::.:.|:|...:|.|.| .|...:|::.:: |||..|..:.:...|...|    .|.|:.|
Yeast    27 NGGTILGIAGEDFAVLAGDTR-NITDYSINSRYEPKVFDCGDNIVMSANGFAAD----GDALVKR 86

  Fly    71 -KN----LYETRENREMCPKPFSAMMSSFLYEHRFGPYFIEPVVAGLDPKTMEPFICNMDLIGCP 130
             ||    .:....::::.....:..:...||..||.||::..::|||| :..:..:.:.|.:|..
Yeast    87 FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLD-EDGKGAVYSFDPVGSY 150

  Fly   131 NAPDDFVVAGTCAEQLYGMCETL--WKPDLEP---------------DQLFEVIAQSIVNAFDRD 178
            .. :.....|..|..:....:..  :|...||               :::.:::..|..:|.:|.
Yeast   151 ER-EQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLSVEEVIKLVRDSFTSATERH 214

  Fly   179 AMSGWGATVYIIEKDKITERTLKTRMD 205
            ...|.|..:.|:.||.:.:...:.:.|
Yeast   215 IQVGDGLEILIVTKDGVRKEFYELKRD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 46/216 (21%)
PRE7NP_009512.1 proteasome_beta_type_1 21..241 CDD:239726 46/220 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.