DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and PBC1

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_564149.1 Gene:PBC1 / 838776 AraportID:AT1G21720 Length:204 Species:Arabidopsis thaliana


Alignment Length:207 Identity:111/207 - (53%)
Similarity:150/207 - (72%) Gaps:5/207 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSILAYNGGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRD 65
            |||..|||..||||.||:|.|||:|.|.|:|.|||:|||:::..|..|:|:||:||.||:.|:..
plant     1 MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDVQTLYQ 65

  Fly    66 RLMFRKNLYETRENREMCPKPFSAMMSSFLYEHRFGPYFIEPVVAGL--DPKTMEPFICNMDLIG 128
            ||:||..||:.||.|:|.|:.|::::|:.|||.|||||..:||:|||  |.|   ||||.||.||
plant    66 RLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDDK---PFICTMDSIG 127

  Fly   129 CPNAPDDFVVAGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVYIIEKD 193
            ......||||:||.:|.|||.||.::|||:|.::|||.|:|:::::.|||.:||||..|||:...
plant   128 AKELAKDFVVSGTASESLYGACEAMYKPDMEAEELFETISQALLSSVDRDCLSGWGGHVYIVTPT 192

  Fly   194 KITERTLKTRMD 205
            :|.||.||.|||
plant   193 EIKERILKGRMD 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 103/196 (53%)
PBC1NP_564149.1 proteasome_beta_type_3 6..200 CDD:239728 103/196 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 211 1.000 Domainoid score I791
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2089
Inparanoid 1 1.050 231 1.000 Inparanoid score I1139
OMA 1 1.010 - - QHG53924
OrthoDB 1 1.010 - - D1170036at2759
OrthoFinder 1 1.000 - - FOG0003566
OrthoInspector 1 1.000 - - otm3344
orthoMCL 1 0.900 - - OOG6_101970
Panther 1 1.100 - - LDO PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2440
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.