DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and PAD2

DIOPT Version :10

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_201415.1 Gene:PAD2 / 836746 AraportID:AT5G66140 Length:250 Species:Arabidopsis thaliana


Alignment Length:130 Identity:26/130 - (20%)
Similarity:50/130 - (38%) Gaps:15/130 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRKN 72
            |...|.:||.|.|.:|.:.:...:.|. |...:|:..:...:.|...||:.|.     |::..|.
plant    30 GNAAVGVRGTDTVVLAVEKKSTPKLQD-SRSARKIVSLDNHIALACAGLKADA-----RVLINKA 88

  Fly    73 LYETRENR---------EMCPKPFSAMMSSFLYEHRFGPYFIEPVVAGLDPKTMEPFICNMDLIG 128
            ..|.:.:|         |...:..:.:...:.......|:.:..::.|.||.:..|.:...|..|
plant    89 RIECQSHRLTLEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLSTLIVGFDPYSRLPSLYQTDPSG 153

  Fly   129  128
            plant   154  153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 26/130 (20%)
PAD2NP_201415.1 proteasome_alpha_type_7 4..210 CDD:239724 26/130 (20%)

Return to query results.
Submit another query.