DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and PAE2

DIOPT Version :10

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_188046.1 Gene:PAE2 / 820649 AraportID:AT3G14290 Length:237 Species:Arabidopsis thaliana


Alignment Length:146 Identity:29/146 - (19%)
Similarity:55/146 - (37%) Gaps:35/146 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GGCVVAMRGKDCVAIATDHRFGIQAQTIS-TDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRK 71
            |...:.::.|:.|.:|.:.|  |.:..:. :..:|:..|...:...::||..|..|:.:...   
plant    34 GSTAIGVKTKEGVVLAVEKR--ITSPLLEPSSVEKIMEIDDHIGCAMSGLIADARTLVEHAR--- 93

  Fly    72 NLYETRENREMCPKPFS------AMMSSFLYEHRFG---------PYFIEPVVAGLDPKTMEPFI 121
              .||:.:|....:|.:      |:....|   |||         |:.:..::||.|......:.
plant    94 --VETQNHRFSYGEPMTVESTTQALCDLAL---RFGEGEEESMSRPFGVSLLIAGHDENGPSLYY 153

  Fly   122 ---------CNMDLIG 128
                     ||...||
plant   154 TDPSGTFWQCNAKAIG 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 29/146 (20%)
PAE2NP_188046.1 proteasome_alpha_type_5 8..218 CDD:239722 29/146 (20%)

Return to query results.
Submit another query.