DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and psmb13a

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_571752.2 Gene:psmb13a / 64280 ZFINID:ZDB-GENE-001208-2 Length:281 Species:Danio rerio


Alignment Length:195 Identity:35/195 - (17%)
Similarity:73/195 - (37%) Gaps:18/195 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRKN 72
            |..:..:..||.|.:..|.|.............|:.:|.|.::....|...|.....|.|.....
Zfish    44 GTTIAGVVFKDGVVLGADTRATSDEVVADKMCAKIHYIAPNIYCCGAGTAADTEKTTDMLSSNLT 108

  Fly    73 LYETRENREMCPKPFSA--MMSSFLYEHRFGPYFIEPVVAGLDPK-----TMEPFICNMDLIGCP 130
            ::.....|.  |:...|  ::...|:.:. |......::.|:|..     |:.|: .:||.:   
Zfish   109 IFSMNSGRN--PRVVMAVNIIQDMLFRYH-GMIGANLILGGVDCTGSHLYTVGPY-GSMDKV--- 166

  Fly   131 NAPDDFVVAGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVYIIEKDKI 195
                .::..|:......|:.|..:|.:::.:|...:::.:|......|..||....:.:|.|:.:
Zfish   167 ----PYLAMGSGDLAAMGILEDRFKVNMDLEQAKALVSDAIQAGIMCDLGSGNNIDLCVITKEGV 227

  Fly   196  195
            Zfish   228  227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 35/195 (18%)
psmb13aNP_571752.2 proteasome_beta_type_7 45..233 CDD:239732 34/194 (18%)
Pr_beta_C 241..272 CDD:315191
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.