DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and PSMA7

DIOPT Version :10

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_002783.1 Gene:PSMA7 / 5688 HGNCID:9536 Length:248 Species:Homo sapiens


Alignment Length:115 Identity:20/115 - (17%)
Similarity:45/115 - (39%) Gaps:15/115 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRKN 72
            |...|.:||:|.|.:..:.:...:.|...| .:|:..:...:.:...||..|.     |::..:.
Human    29 GSTAVGVRGRDIVVLGVEKKSVAKLQDERT-VRKICALDDNVCMAFAGLTADA-----RIVINRA 87

  Fly    73 LYETRENR---------EMCPKPFSAMMSSFLYEHRFGPYFIEPVVAGLD 113
            ..|.:.:|         |...:..:::...:...:...|:.|..::.|.|
Human    88 RVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFD 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 20/115 (17%)
PSMA7NP_002783.1 proteasome_alpha_type_7 3..211 CDD:239724 20/115 (17%)

Return to query results.
Submit another query.