DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and PSMA4

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001096137.1 Gene:PSMA4 / 5685 HGNCID:9533 Length:261 Species:Homo sapiens


Alignment Length:124 Identity:27/124 - (21%)
Similarity:54/124 - (43%) Gaps:19/124 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSILAYNGGCVVAMRGKDCVAIATDHRFGIQAQTISTDF-KKVFHIGPRMFLGLTGLQTD--ILT 62
            |..:.:.|.| :.:...|.|.:|.:.| .|........| :|::.:...|...:.|:.:|  :||
Human    25 MEAIGHAGTC-LGILANDGVLLAAERR-NIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLT 87

  Fly    63 VRDRLMFRKNLYETRENREMCPKPFSAMMSSF-----LYEHRFG---PYFIEPVVAGLD 113
            ...||:.::.|.:.:|     |.|...::::.     .|. :||   |:.:..:..|.|
Human    88 NELRLIAQRYLLQYQE-----PIPCEQLVTALCDIKQAYT-QFGGKRPFGVSLLYIGWD 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 26/119 (22%)
PSMA4NP_001096137.1 proteasome_alpha_type_4 3..216 CDD:239721 27/124 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.