DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and psmb3

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001016503.1 Gene:psmb3 / 549257 XenbaseID:XB-GENE-1008325 Length:205 Species:Xenopus tropicalis


Alignment Length:205 Identity:132/205 - (64%)
Similarity:173/205 - (84%) Gaps:0/205 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSILAYNGGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRD 65
            |||::||||.::|||||||||||.|.|||:|||.::|||:|:|.:|.|:::||.||.||:.||..
 Frog     1 MSIMSYNGGAIMAMRGKDCVAIAADRRFGVQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVSQ 65

  Fly    66 RLMFRKNLYETRENREMCPKPFSAMMSSFLYEHRFGPYFIEPVVAGLDPKTMEPFICNMDLIGCP 130
            ||.||.||||.:|.|::.||.|.:|:::.|||.|||||:||||:|||||||.:||||::||||||
 Frog    66 RLKFRLNLYELKEGRQIKPKTFMSMVANLLYERRFGPYYIEPVIAGLDPKTFKPFICSLDLIGCP 130

  Fly   131 NAPDDFVVAGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVYIIEKDKI 195
            ...:||||:|||:||:|||||:||:||:||:.|||.|:|:::||.||||:||.|..|::||||||
 Frog   131 METEDFVVSGTCSEQMYGMCESLWEPDMEPEDLFETISQAMLNAVDRDAVSGMGVVVHVIEKDKI 195

  Fly   196 TERTLKTRMD 205
            |.||||.|||
 Frog   196 TTRTLKARMD 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 124/194 (64%)
psmb3NP_001016503.1 proteasome_beta_type_3 6..201 CDD:239728 124/194 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 264 1.000 Domainoid score I1876
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2089
Inparanoid 1 1.050 296 1.000 Inparanoid score I2679
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1170036at2759
OrthoFinder 1 1.000 - - FOG0003566
OrthoInspector 1 1.000 - - oto102291
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1011
SonicParanoid 1 1.000 - - X2440
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.