DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and Prosalpha1

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster


Alignment Length:231 Identity:44/231 - (19%)
Similarity:72/231 - (31%) Gaps:78/231 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VAMRGKDCVAIATDHRF---GIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRKNL 73
            ||::..||..:||..:.   .|..:|::..|:....||    ..:||...|     .|...:|..
  Fly    40 VALKSGDCAVVATQKKVTEKNIVPETVTHLFRITKDIG----CAMTGRIAD-----SRSQVQKAR 95

  Fly    74 YET---------------------------RENREMCPKPFSAMMSSFLYEHRFGP--------- 102
            ||.                           .:|.||  :|....|....|::..||         
  Fly    96 YEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEM--RPLGCSMVLIAYDNEIGPSVYKTDPAG 158

  Fly   103 YFIEPVVAGLDPKTMEPFICNMDLIGCPNAPDDFVVAGTCAEQLYGMCETLWKPDLEPDQLFEVI 167
            ||.......:..||:|                    |.:..|:.|       ||:|..::..::.
  Fly   159 YFSGFKACSVGAKTLE--------------------ANSYLEKKY-------KPNLSEEKAIQLA 196

  Fly   168 AQSIVNAFDRDAMSGWGATVYIIEKDKITERTLKTR 203
            ...:.:....|.... |..:.::.|...|.|.|..|
  Fly   197 ISCLSSVLAIDFKPN-GIEIGVVSKSDPTFRILDER 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 42/227 (19%)
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 44/231 (19%)
proteasome_alpha_type_6 8..218 CDD:239723 39/216 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441031
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.