DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and psmb2

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001002609.1 Gene:psmb2 / 436882 ZFINID:ZDB-GENE-040718-353 Length:199 Species:Danio rerio


Alignment Length:192 Identity:44/192 - (22%)
Similarity:83/192 - (43%) Gaps:14/192 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRKNLYE 75
            ::.::|.|.|.:|.|:........:..|:.|:|.:..::.|...|...|.:...:.:.....||:
Zfish     4 LIGIQGPDFVLVAADNVAASSIIQMKHDYDKMFKLSEKILLLCVGEAGDTVQFAEYIQKNVQLYK 68

  Fly    76 TRENREMCPKPFSAMMSSFL------YEHRFGPYFIEPVVAGLDPKTMEPFICNMD-LIGCPNAP 133
            .|...|:.|    |..::|.      |.....||.:..::||.| :|..|.:..|| |.....||
Zfish    69 MRNGYELSP----AAAANFTRKNLADYLRSRTPYHVNLLLAGYD-ETDGPGLYYMDYLSALAKAP 128

  Fly   134 DDFVVAGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVYIIEKDKI 195
              |...|..|.....:.:..::|||..::..:::.:.:.....|..::....||.:|:||.|
Zfish   129 --FAAHGYGAFLTLSILDRYYRPDLTREEAVDLLKKCLEELNKRFILNLPSFTVRLIDKDGI 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 44/192 (23%)
psmb2NP_001002609.1 proteasome_beta_type_2 1..192 CDD:239727 44/192 (23%)
PRE1 5..188 CDD:223711 43/189 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.