DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and psmb10

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001002543.2 Gene:psmb10 / 436816 ZFINID:ZDB-GENE-040718-278 Length:276 Species:Danio rerio


Alignment Length:197 Identity:38/197 - (19%)
Similarity:71/197 - (36%) Gaps:22/197 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRKN 72
            |..:..:..||.|.:..|.|..........:..|:.:|.|.::....|:..|.......:.....
Zfish    42 GTTIAGLVFKDGVILGADTRATDDMVVADKNCMKIHYIAPNIYCCGAGVAADAEVTTQMMSSNVE 106

  Fly    73 LYETRENREMCPKPFSAMMSS------FLYEHRFGPYFIEPVVAGLDPKTMEPFICNMDLIGCPN 131
            |:.....|    .|..||::.      |.|:...|...|   |.|:|....:.:..      .|:
Zfish   107 LHSLSTGR----PPLVAMVTRQLKQMLFRYQGHIGSSLI---VGGVDVNGAQLYSV------YPH 158

  Fly   132 APDD---FVVAGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVYIIEKD 193
            ...|   |:..|:.|.....:.|..:||::|.::..:::..:|......|..||....:.:|...
Zfish   159 GSYDKLPFLTMGSGAASAISVFEDRYKPNMELEEAKQLVRDAITAGIFCDLGSGSNVDLCVITDK 223

  Fly   194 KI 195
            |:
Zfish   224 KV 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 38/197 (19%)
psmb10NP_001002543.2 PRE1 40..224 CDD:223711 37/194 (19%)
proteasome_beta_type_7 43..231 CDD:239732 37/196 (19%)
Pr_beta_C 237..270 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.