Sequence 1: | NP_649858.1 | Gene: | Prosbeta3 / 41079 | FlyBaseID: | FBgn0026380 | Length: | 205 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002543.2 | Gene: | psmb10 / 436816 | ZFINID: | ZDB-GENE-040718-278 | Length: | 276 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 38/197 - (19%) |
---|---|---|---|
Similarity: | 71/197 - (36%) | Gaps: | 22/197 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 GGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRKN 72
Fly 73 LYETRENREMCPKPFSAMMSS------FLYEHRFGPYFIEPVVAGLDPKTMEPFICNMDLIGCPN 131
Fly 132 APDD---FVVAGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVYIIEKD 193
Fly 194 KI 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta3 | NP_649858.1 | proteasome_beta_type_3 | 6..201 | CDD:239728 | 38/197 (19%) |
psmb10 | NP_001002543.2 | PRE1 | 40..224 | CDD:223711 | 37/194 (19%) |
proteasome_beta_type_7 | 43..231 | CDD:239732 | 37/196 (19%) | ||
Pr_beta_C | 237..270 | CDD:289249 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |