DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and psma8

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_998331.1 Gene:psma8 / 406445 ZFINID:ZDB-GENE-040426-2194 Length:251 Species:Danio rerio


Alignment Length:149 Identity:32/149 - (21%)
Similarity:50/149 - (33%) Gaps:40/149 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDI------------ 60
            |...|.:||||.|.:..:.:...:.|...| .:|:..:...:.:...||..|.            
Zfish    31 GSTAVGIRGKDIVVLGVEKKSVAKLQEERT-VRKICALDEHVCMAFAGLTADARIVINRARVECQ 94

  Fly    61 ---LTVRDRLMFR---------KNLYETRENREMCPKPF--SAMMSSFLYEHRFGPYFIEPV--- 108
               |||.|.:...         |..|.....|    :||  ||::..|.|:.....|..:|.   
Zfish    95 SHRLTVEDPVTVEYITRYIATLKQRYTQSNGR----RPFGISALIVGFDYDGTPRLYQTDPSGTY 155

  Fly   109 ------VAGLDPKTMEPFI 121
                  ..|...||:..|:
Zfish   156 HAWKANAIGRSAKTVREFL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 32/149 (21%)
psma8NP_998331.1 proteasome_alpha_type_7 5..213 CDD:239724 32/149 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.