DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and Prosbeta7

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_649529.1 Gene:Prosbeta7 / 40639 FlyBaseID:FBgn0250746 Length:268 Species:Drosophila melanogaster


Alignment Length:144 Identity:41/144 - (28%)
Similarity:70/144 - (48%) Gaps:10/144 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVR---DRLMF 69
            |..|:.:|....|.:|.|......:.....:.::||.:...:.||.:|...||.:::   |:.|.
  Fly    57 GTSVLGIRYDSGVMLAADTLVSYGSMARYQNIERVFKVNKNILLGGSGDFADIQSIKRNIDQKMI 121

  Fly    70 RKNLYETRENREMCPKPFSAMMSSFLYEH--RFGPYFIEPVVAGLDPKTMEPFICNMDLIGCPNA 132
            .....:  :|.||.||..::.|:..||..  |..|.:|:.||.|:|.:. .|::.|:||.|  .:
  Fly   122 EDQCCD--DNIEMKPKSLASWMTRVLYNRRSRMNPLYIDVVVGGVDNEG-TPYLANVDLRG--RS 181

  Fly   133 PDDFVVAGTCAEQL 146
            .:|:|||...|..|
  Fly   182 YEDYVVATGFARHL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 41/144 (28%)
Prosbeta7NP_649529.1 proteasome_beta_type_4 60..252 CDD:239729 40/141 (28%)
PRE1 60..232 CDD:223711 40/141 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441149
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.