DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and Prosbeta5R1

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_611776.1 Gene:Prosbeta5R1 / 37690 FlyBaseID:FBgn0034842 Length:315 Species:Drosophila melanogaster


Alignment Length:189 Identity:40/189 - (21%)
Similarity:87/189 - (46%) Gaps:15/189 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YNGGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFR 70
            |.||.::....:     ||..:: |.:||:    :|:..:...|...|.|...|.: ..||::.:
  Fly    79 YRGGVILCADSR-----ATSGQY-IGSQTM----RKIVELNDYMLGTLAGGAADCV-YWDRVLAK 132

  Fly    71 K-NLYETRENREMCPKPFSAMMSSFLYEHRFGPYFIEPVVAGLDPKTMEPFICNMDLIGCPNAPD 134
            : .|::.|..:.|.....:.::.:...|::.....:..::||.|.:  .|.:..:|..|..:...
  Fly   133 ECRLHQLRYRKRMTVDTAARIICNISTEYKGMGLVMGMMLAGFDDE--GPKLIYVDSEGMRSHGQ 195

  Fly   135 DFVVAGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVYIIEKD 193
            .|.| |:.:....|:.:|.::.||...:.:::..::|.:|..:||.||....:|.|..:
  Fly   196 VFSV-GSGSPYALGVLDTGYRYDLSDQEAYDLARRAIYHATSKDAYSGGIVRLYHIHSE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 40/189 (21%)
Prosbeta5R1NP_611776.1 PTZ00488 39..272 CDD:185666 40/189 (21%)
proteasome_beta_type_5 72..259 CDD:239730 40/189 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440944
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.