DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and Prosalpha7

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster


Alignment Length:215 Identity:45/215 - (20%)
Similarity:84/215 - (39%) Gaps:34/215 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GCVVAMRGKDCVAIATDHRFGIQAQTISTDF-KKVFHIGPRMFLGLTGLQTDILTVRD-----RL 67
            |.|:.:||||.|.:|.:..  |.::....|. .::|.|...:.:.:.||..|...|.|     ..
  Fly    35 GTVIGIRGKDAVVLAVEKI--ITSKLYEPDAGGRIFTIEKNIGMAVAGLVADGNFVADIARQEAA 97

  Fly    68 MFRKNLYETRENREMCPKPFSAMMSSFLYEHRFGPYFIEPVVAGLD----PK--TMEPFICNMDL 126
            .:|:...:....:.:|.:....:.:..||. ...|:.:..::|..|    |:  .:||...:...
  Fly    98 NYRQQFEQAIPLKHLCHRVAGYVHAYTLYS-AVRPFGLSIILASWDEVEGPQLYKIEPSGSSFGY 161

  Fly   127 IGCPNAPDDFVVAGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAF----DRDAMSGWGAT- 186
            ..|.:.... .:|.|..|:|        |.|:..|:|.|...:.|....    |:|.....|.. 
  Fly   162 FACASGKAK-QLAKTEMEKL--------KMDMRTDELVESAGEIIYKVHDELKDKDFRFEMGLVG 217

  Fly   187 -----VYIIEKDKITERTLK 201
                 :::|...::||:..|
  Fly   218 RVTGGLHLINPSELTEKARK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 44/213 (21%)
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 41/192 (21%)
PRE1 6..231 CDD:223711 42/207 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441006
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.