DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and Prosbeta4

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster


Alignment Length:192 Identity:41/192 - (21%)
Similarity:79/192 - (41%) Gaps:10/192 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRKN--L 73
            ::.::|.|.|.:|.|.........:..|..|:..:...:.:...|...|  |.:......||  |
  Fly     4 LLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGD--TEQFTEFISKNIAL 66

  Fly    74 YETRENREMCPKPFSAMMSSFLYEHRFG--PYFIEPVVAGLDPKTMEPFICNMDLIGCPNA-PDD 135
            |:.|...::.|:..:......|.|:...  ||.:...|||.||.. .|.:..:|.:.  || |.:
  Fly    67 YKMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNA-GPELTFIDYLA--NALPVN 128

  Fly   136 FVVAGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVYIIEKDKITE 197
            :...|..|.....:.:..|.|::...:.::|..:.|.....|..::....||.:::||.:.:
  Fly   129 YAGHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVDKDGVRD 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 41/192 (21%)
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 41/192 (21%)
proteasome_beta_type_2 1..192 CDD:239727 41/192 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441114
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.