DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and Prosbeta4R2

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster


Alignment Length:189 Identity:33/189 - (17%)
Similarity:74/189 - (39%) Gaps:16/189 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VVAMRGKDCVAIATDHRFGIQAQTI---STDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRKN 72
            ::.::|.|.|.:|:|   .:||:::   ..|..|:..:.....:...|...|.:...|.:....:
  Fly     6 ILGIKGPDFVMLASD---TMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDFISKNLH 67

  Fly    73 LYETRENREMCPKPFSAMMSSFL--YEHRFGPYFIEPVVAGLDPKTME-PFICNMDLIGCPNAPD 134
            ||:......:..|..:......|  |......|.:..::||.|  .:| |.:..:|..|   |..
  Fly    68 LYKISHGYHLSAKSAAHFTRKTLADYIRTNTRYQVAMLLAGYD--AVEGPDLHYIDSYG---AAQ 127

  Fly   135 DFVVAGTCAEQLY--GMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVYIIE 191
            ....||.....::  .:.:..|...|..:..:.::.:.::....|..::.....||:::
  Fly   128 SINHAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRLIINQRNFEVYVVD 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 33/189 (17%)
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 33/189 (17%)
proteasome_beta_type_2 3..194 CDD:239727 33/189 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441113
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.