DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and psmb8a

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_571467.3 Gene:psmb8a / 30666 ZFINID:ZDB-GENE-990415-141 Length:271 Species:Danio rerio


Alignment Length:199 Identity:41/199 - (20%)
Similarity:85/199 - (42%) Gaps:27/199 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NGGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRK 71
            :|...:|.:.:..|.:|.|.|........|.:..||..|.|.:...::|...| ....:||:.::
Zfish    66 HGTTTLAFKFRHGVIVAVDSRASAGKYIASKEANKVIEINPYLLGTMSGSAAD-CQYWERLLAKE 129

  Fly    72 -NLYETRENREMCPKPFSAMMSSFLYEHRFGPYFIEPVVAGLDPKTMEPFICNMD---------- 125
             .||:.|..:.:.....|.::|:.:..:|.....:..::.|.|.:  .|.:..:|          
Zfish   130 CRLYKLRNKQRISVSAASKLLSNMMLGYRGMGLSMGSMICGWDKQ--GPGLYYVDDNGTRLSGRM 192

  Fly   126 -LIGCPNAPDDFVVAGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVYI 189
             ..||.|:            ..||:.::.::.|:..::.:|:..:.|.:|..|||.||....:|.
Zfish   193 FSTGCGNS------------YAYGVVDSGYREDMTVEEAYELGRRGIAHATHRDAYSGGVVNLYH 245

  Fly   190 IEKD 193
            :::|
Zfish   246 MQED 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 41/199 (21%)
psmb8aNP_571467.3 PTZ00488 37..266 CDD:185666 41/199 (21%)
proteasome_beta_type_5 68..255 CDD:239730 40/197 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.