DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and Psmb2

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_058980.1 Gene:Psmb2 / 29675 RGDID:61874 Length:201 Species:Rattus norvegicus


Alignment Length:188 Identity:39/188 - (20%)
Similarity:77/188 - (40%) Gaps:6/188 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRKNLYE 75
            ::.::|.|.|.:|:|.........:..|..|:|.:..::.|...|...|.:...:.:.....||:
  Rat     4 LIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYK 68

  Fly    76 TRENREMCPKPFSAMMSSFLYE--HRFGPYFIEPVVAGLDPKTMEPFICNMD-LIGCPNAPDDFV 137
            .|...|:.|...:......|.:  ....||.:..::||.| :...|.:..|| |.....||  |.
  Rat    69 MRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYD-EHEGPALYYMDYLAALAKAP--FA 130

  Fly   138 VAGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVYIIEKDKI 195
            ..|..|.....:.:..:.|.:..::..|::.:.:.....|..::....:|.:|:||.|
  Rat   131 AHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRVIDKDGI 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 39/188 (21%)
Psmb2NP_058980.1 proteasome_beta_type_2 1..192 CDD:239727 39/188 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.