DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and Psmb5

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001099197.2 Gene:Psmb5 / 29425 RGDID:61879 Length:263 Species:Rattus norvegicus


Alignment Length:201 Identity:46/201 - (22%)
Similarity:85/201 - (42%) Gaps:31/201 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NGGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRK 71
            :|...:|.:.:..|.:|.|.|....|...|...|||..|.|.:...:.|...| .:..:||:.|:
  Rat    58 HGTTTLAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAAD-CSFWERLLARQ 121

  Fly    72 -NLYETRENREMCPKPFSAMMSSFLYEHRFGPYFIEPVVAGLDPKTMEPFICNMDLIGCPNAPDD 135
             .:||.|....:.....|.::::.:|:::         ..||...||   ||..|..|    |..
  Rat   122 CRIYELRNKERISVAAASKLLANMVYQYK---------GMGLSMGTM---ICGWDKRG----PGL 170

  Fly   136 FVV-------------AGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATV 187
            :.|             .|:.:...:|:.:..:..||:.::.:::..::|..|..|||.||....:
  Rat   171 YYVDSEGNRISGTAFSVGSGSVYAFGVMDRGYSYDLQVEEAYDLARRAIYQATYRDAYSGGAVNL 235

  Fly   188 YIIEKD 193
            |.:.:|
  Rat   236 YHVRED 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 46/201 (23%)
Psmb5NP_001099197.2 PTZ00488 29..263 CDD:185666 46/201 (23%)
proteasome_beta_type_5 60..247 CDD:239730 45/199 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.