Sequence 1: | NP_649858.1 | Gene: | Prosbeta3 / 41079 | FlyBaseID: | FBgn0026380 | Length: | 205 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001020808.1 | Gene: | Psmb10 / 291983 | RGDID: | 1307428 | Length: | 273 | Species: | Rattus norvegicus |
Alignment Length: | 196 | Identity: | 30/196 - (15%) |
---|---|---|---|
Similarity: | 64/196 - (32%) | Gaps: | 30/196 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 GGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRKN 72
Fly 73 LYETRENREMCPKPFSAMMSSFLYEHRFGPYFIEPVVAGLDPKTMEPFICNMDLIGCPNAPD--- 134
Fly 135 ----------DFVVAGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVYI 189
Fly 190 I 190 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta3 | NP_649858.1 | proteasome_beta_type_3 | 6..201 | CDD:239728 | 30/196 (15%) |
Psmb10 | NP_001020808.1 | proteasome_beta_type_7 | 40..226 | CDD:239732 | 29/195 (15%) |
Pr_beta_C | 233..267 | CDD:403609 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |