DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and Psmb2

DIOPT Version :10

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_036100.3 Gene:Psmb2 / 26445 MGIID:1347045 Length:201 Species:Mus musculus


Alignment Length:188 Identity:39/188 - (20%)
Similarity:77/188 - (40%) Gaps:6/188 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRKNLYE 75
            ::.::|.|.|.:|:|.........:..|..|:|.:..::.|...|...|.:...:.:.....||:
Mouse     4 LIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYK 68

  Fly    76 TRENREMCPKPFSAMMSSFLYE--HRFGPYFIEPVVAGLDPKTMEPFICNMD-LIGCPNAPDDFV 137
            .|...|:.|...:......|.:  ....||.:..::||.| :...|.:..|| |.....||  |.
Mouse    69 MRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYD-EHEGPALYYMDYLAALAKAP--FA 130

  Fly   138 VAGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVYIIEKDKI 195
            ..|..|.....:.:..:.|.:..::..|::.:.:.....|..::....:|.:|:||.|
Mouse   131 AHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRVIDKDGI 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 39/188 (21%)
Psmb2NP_036100.3 proteasome_beta_type_2 1..192 CDD:239727 39/188 (21%)

Return to query results.
Submit another query.