DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and Psma4

DIOPT Version :10

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_036096.1 Gene:Psma4 / 26441 MGIID:1347060 Length:261 Species:Mus musculus


Alignment Length:124 Identity:27/124 - (21%)
Similarity:54/124 - (43%) Gaps:19/124 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSILAYNGGCVVAMRGKDCVAIATDHRFGIQAQTISTDF-KKVFHIGPRMFLGLTGLQTD--ILT 62
            |..:.:.|.| :.:...|.|.:|.:.| .|........| :|::.:...|...:.|:.:|  :||
Mouse    25 MEAIGHAGTC-LGILANDGVLLAAERR-NIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLT 87

  Fly    63 VRDRLMFRKNLYETRENREMCPKPFSAMMSSF-----LYEHRFG---PYFIEPVVAGLD 113
            ...||:.::.|.:.:|     |.|...::::.     .|. :||   |:.:..:..|.|
Mouse    88 NELRLIAQRYLLQYQE-----PIPCEQLVTALCDIKQAYT-QFGGKRPFGVSLLYIGWD 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 26/119 (22%)
Psma4NP_036096.1 proteasome_alpha_type_4 3..216 CDD:239721 27/124 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.