DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and Psma1

DIOPT Version :10

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_036095.1 Gene:Psma1 / 26440 MGIID:1347005 Length:263 Species:Mus musculus


Alignment Length:135 Identity:33/135 - (24%)
Similarity:57/135 - (42%) Gaps:25/135 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GGCVVAMRGKDCVAIATDHRFGIQAQT-ISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRK 71
            |...|.::.|....:....|    ||: ::...||:.|:...:.:.:.||..|.     ||:...
Mouse    32 GSATVGLKSKTHAVLVALKR----AQSELAAHQKKILHVDNHIGISIAGLTADA-----RLLCNF 87

  Fly    72 NLYETRENREMC--PKPFSAMMS-----SFLYEHRFG--PYFIEPVVAGLDPKTMEPFICNMDLI 127
            ...|..::|.:.  |.|.|.::|     :.:...|:|  ||.:..::||.|  .|.|.|...   
Mouse    88 MRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYD--DMGPHIFQT--- 147

  Fly   128 GCPNA 132
             ||:|
Mouse   148 -CPSA 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 33/135 (24%)
Psma1NP_036095.1 proteasome_alpha_type_1 6..216 CDD:239718 33/135 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..263
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.