DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and Psmb10

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_038668.2 Gene:Psmb10 / 19171 MGIID:1096380 Length:273 Species:Mus musculus


Alignment Length:108 Identity:28/108 - (25%)
Similarity:40/108 - (37%) Gaps:37/108 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IATDHRFGIQAQTISTDFKKVFHIGPRMFLG---LTGLQTDILTVRDRLMFRKNLYETRENREMC 83
            :||..|  |..||:   |:...|:|..:.:|   |.|.|               |||...:....
Mouse   115 VATVTR--ILRQTL---FRYQGHVGASLVVGGVDLNGPQ---------------LYEVHPHGSYS 159

  Fly    84 PKPFSAMMSS-----FLYEHRFGP---------YFIEPVVAGL 112
            ..||:|:.|.     .|.|.||.|         ..:|.:.||:
Mouse   160 RLPFTALGSGQGAAVALLEDRFQPNMTLEAAQELLVEAITAGI 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 28/108 (26%)
Psmb10NP_038668.2 20S_bact_beta 39..238 CDD:163402 28/108 (26%)
proteasome_beta_type_7 40..226 CDD:239732 28/108 (26%)
Pr_beta_C 232..267 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.