Sequence 1: | NP_649858.1 | Gene: | Prosbeta3 / 41079 | FlyBaseID: | FBgn0026380 | Length: | 205 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_498806.1 | Gene: | pbs-6 / 176161 | WormBaseID: | WBGene00003952 | Length: | 258 | Species: | Caenorhabditis elegans |
Alignment Length: | 209 | Identity: | 49/209 - (23%) |
---|---|---|---|
Similarity: | 90/209 - (43%) | Gaps: | 12/209 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 GGCVVAMRGKDCVAIATDHRFGIQAQTIST-DFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRK 71
Fly 72 NLYETRENREMCPKPFSAMMSSFLYEHRFGPYFIEPVVAGLDPKTMEPFICNMDLIGC------- 129
Fly 130 -PNAPDDFVVAG-TCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVYIIEK 192
Fly 193 DK-ITERTLKTRMD 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta3 | NP_649858.1 | proteasome_beta_type_3 | 6..201 | CDD:239728 | 46/203 (23%) |
pbs-6 | NP_498806.1 | PRE1 | 38..246 | CDD:223711 | 45/195 (23%) |
Ntn_hydrolase | 44..258 | CDD:294319 | 48/207 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D435362at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |