DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and pbs-2

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_493271.1 Gene:pbs-2 / 173168 WormBaseID:WBGene00003948 Length:277 Species:Caenorhabditis elegans


Alignment Length:196 Identity:42/196 - (21%)
Similarity:76/196 - (38%) Gaps:20/196 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LAYNGGCVVAMRGKDCVAIATDHRFGIQAQTISTD--FKKVFHIGPRMFLGLTGLQTDILTVRDR 66
            |...|..:||:..|..:.:..|.|  ..|..|..|  .:||..:...::....|...|:..|...
 Worm    42 LTSTGTTIVAVAFKGGLVMGADSR--ATAGNIIADKHCEKVHKLTESIYACGAGTAADLDQVTKM 104

  Fly    67 LMFRKNLYETRENREMCPKPFSAMMSS----FLYEHRFGPYFIEPVVAGLDPKTMEPFIC--NMD 125
            |.....|.|....|:  .:..:|:..:    |.|:...|.|.:   :.|:||.....::|  |..
 Worm   105 LSGNLRLLELNTGRK--ARVITALRQAKQHLFNYQGYIGAYLL---IGGVDPTGPHLYMCSANGT 164

  Fly   126 LIGCPNAPDDFVVAGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVYII 190
            .:..|     |...|:.:.....:.|..:|.|:..|:..:::.:::......|..||....:.||
 Worm   165 TMAFP-----FTAQGSGSYAAITILERDFKVDMTKDEAEKLVQRALEAGMHGDNASGNSLNLVII 224

  Fly   191 E 191
            |
 Worm   225 E 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 41/194 (21%)
pbs-2NP_493271.1 PRE1 43..228 CDD:223711 41/195 (21%)
proteasome_beta_type_7 47..235 CDD:239732 40/191 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.