DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and Psmb8

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_034854.2 Gene:Psmb8 / 16913 MGIID:1346527 Length:276 Species:Mus musculus


Alignment Length:188 Identity:42/188 - (22%)
Similarity:85/188 - (45%) Gaps:5/188 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NGGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRK 71
            :|...:|.:.:..|.:|.|.|....:...|....||..|.|.:...::|...| ....:||:.::
Mouse    71 HGTTTLAFKFQHGVIVAVDSRATAGSYISSLRMNKVIEINPYLLGTMSGCAAD-CQYWERLLAKE 134

  Fly    72 -NLYETRENREMCPKPFSAMMSSFLYEHRFGPYFIEPVVAGLDPKTMEPFICNMDLIGCPNAPDD 135
             .||..|....:.....|.::|:.:.::|.....:..::.|.|.|  .|.:..:|..|...:...
Mouse   135 CRLYYLRNGERISVSAASKLLSNMMLQYRGMGLSMGSMICGWDKK--GPGLYYVDDNGTRLSGQM 197

  Fly   136 FVVAGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVYIIEKD 193
            | ..|:.....||:.::.::.||.|::.:::..::|..|..||..||....:|.:::|
Mouse   198 F-STGSGNTYAYGVMDSGYRQDLSPEEAYDLGRRAIAYATHRDNYSGGVVNMYHMKED 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 42/188 (22%)
Psmb8NP_034854.2 PTZ00488 40..271 CDD:185666 42/188 (22%)
proteasome_beta_type_5 73..260 CDD:239730 41/186 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.