DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and Prosalpha3

DIOPT Version :10

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_315057.4 Gene:Prosalpha3 / 1275771 VectorBaseID:AGAMI1_013809 Length:259 Species:Anopheles gambiae


Alignment Length:49 Identity:12/49 - (24%)
Similarity:24/49 - (48%) Gaps:10/49 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 YGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVYIIEKDKI 195
            |....|::.|:   .:|::|       .:..:|:|..|.::.|:.||.|
Mosquito     5 YDSRTTIFSPE---GRLYQV-------EYAMEAISHAGTSLGILAKDGI 43

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 12/49 (24%)
Prosalpha3XP_315057.4 proteasome_alpha_type_4 3..216 CDD:239721 12/49 (24%)

Return to query results.
Submit another query.