DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and PSMB11

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001093250.1 Gene:PSMB11 / 122706 HGNCID:31963 Length:300 Species:Homo sapiens


Alignment Length:226 Identity:48/226 - (21%)
Similarity:75/226 - (33%) Gaps:55/226 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NGGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRK 71
            :|...:|.|.:..|..|.|.|....:........||..:...:....:|...|..|....|....
Human    48 HGTTTLAFRFRHGVIAAADTRSSCGSYVACPASCKVIPVHQHLLGTTSGTSADCATWYRVLQREL 112

  Fly    72 NLYETRENR----EMCPKPFSAMMSSFLYEHRFGPYFIEPVVAGLDPKTMEPFICNMDLIGCPNA 132
            .|.|.||.:    ....|..|||||.:               .||| ..:...:|..|..|    
Human   113 RLRELREGQLPSVASAAKLLSAMMSQY---------------RGLD-LCVATALCGWDRSG---- 157

  Fly   133 PDDFVV-------------AGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAM---- 180
            |:.|.|             .|:.:...||:.:..::.|:...:.:.:...::.:|..|||.    
Human   158 PELFYVYSDGTRLQGDIFSVGSGSPYAYGVLDRGYRYDMSTQEAYALARCAVAHATHRDAYSGGS 222

  Fly   181 --------SGW------GATVYIIEKDKITE 197
                    |||      .|.|..:|..|:.|
Human   223 VDLFHVRESGWEHVSRSDACVLYVELQKLLE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 48/226 (21%)
PSMB11NP_001093250.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
proteasome_beta_type_5 50..237 CDD:239730 42/206 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.