DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta3 and psmb5

DIOPT Version :9

Sequence 1:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_002941560.1 Gene:psmb5 / 100379732 XenbaseID:XB-GENE-975048 Length:257 Species:Xenopus tropicalis


Alignment Length:201 Identity:48/201 - (23%)
Similarity:84/201 - (41%) Gaps:31/201 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NGGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRK 71
            :|...:|.:.:..|.:|.|.|....|...|...|||..|.|.:...:.|...| .:..:||:.|:
 Frog    52 HGTTTLAFKFRHGVIVAVDSRATAGAYIASQTVKKVIEINPYLLGTMAGGAAD-CSFWERLLARQ 115

  Fly    72 -NLYETRENREMCPKPFSAMMSSFLYEHRFGPYFIEPVVAGLDPKTMEPFICNMDLIGCPNAPDD 135
             .:||.|....:.....|.::::.:|:::         ..||...||   ||..|..|    |..
 Frog   116 CRIYELRNKERISVAAASKLLANMVYQYK---------GMGLSMGTM---ICGWDKRG----PGL 164

  Fly   136 FVV-------------AGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATV 187
            :.|             .|:.:...||:.:..:..::|.::..|:..:||..|..|||.||....:
 Frog   165 YYVDSEGNRVSGSVFSVGSGSMYAYGVLDRGYNYEMEVEEAQELARRSIYQATYRDAYSGGVVNL 229

  Fly   188 YIIEKD 193
            |.:.:|
 Frog   230 YHVRED 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 48/201 (24%)
psmb5XP_002941560.1 proteasome_beta_type_5 54..241 CDD:239730 47/199 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.