DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11980 and AT3G49320

DIOPT Version :9

Sequence 1:NP_649857.1 Gene:CG11980 / 41078 FlyBaseID:FBgn0037652 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_190501.1 Gene:AT3G49320 / 824094 AraportID:AT3G49320 Length:354 Species:Arabidopsis thaliana


Alignment Length:331 Identity:134/331 - (40%)
Similarity:201/331 - (60%) Gaps:19/331 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IGTHSGTFHCDELVACFMLKQLDEYKNAEIFRSRDNKALKEKCDIIVDVGGVYDHAKKLYDHHQI 92
            :|||:|||||||.:|||:|::.:.:.:|:|.|:||::.| ||.|..:|||||||...:.|||||.
plant    34 VGTHNGTFHCDEALACFILRRSNRFSDAQIVRTRDHQVL-EKLDAALDVGGVYDPQSERYDHHQK 97

  Fly    93 TFKETFSSVRPDVSEDYNVVRLSSAGLVYCHYGERVIQSILQREKGIKLSPENLQTAFIQIYRNF 157
            .|.|.|..       .:| .:||||||||.|||..:|...||.|   :..|:..: .|:.:|:||
plant    98 GFSEVFGL-------GFN-TKLSSAGLVYKHYGLEIISKELQLE---QRHPDVFR-LFLAVYKNF 150

  Fly   158 INELDAIDNGVPMFEGVE-PIYKISTHLSARIAKLNPSW---QETGVDIEDRFRQAMDTAGREFV 218
            |..:||:|||:..::..: |.|..:|.|..||.:||..|   .::....::.|.:||:.||.||:
plant   151 IEAVDALDNGIHQYDTDQPPRYVNNTSLGHRIGRLNLDWIEPDQSSAKEDEAFHRAMELAGSEFL 215

  Fly   219 DNVVEVSCSWIPARDHVREALKNAKNVHPTGEILVLKNFCPWKSHLFDLEKEYKVEGVPKLVVFN 283
            :.|...:.||:|||..|.|.|....::..:|||:.|...||||.|:|:||:|.|::...|.|::.
plant   216 ECVHFHAKSWLPARSIVMECLAKRYDIDSSGEIMKLSKQCPWKLHIFELEEEMKIDPPIKYVLYQ 280

  Fly   284 SGNS--WRVAGVPVTPGSYLGRKFLPTPWRGLMDDELCDKASIKDLEFIHHTGFIGGAKTEEAAM 346
            ...|  ||:..|.|:|..:..||.||..||||..::|.:::||....|:|.:||||..:|.|.|:
plant   281 DDRSENWRIQAVSVSPERFESRKALPLAWRGLEKEKLSEESSIPRCVFVHMSGFIGANQTYEGAL 345

  Fly   347 LLAKKS 352
            .:|:.|
plant   346 AMARAS 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11980NP_649857.1 UPF0160 28..352 CDD:281655 133/329 (40%)
AT3G49320NP_190501.1 UPF0160 33..352 CDD:377098 134/331 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 254 1.000 Domainoid score I501
eggNOG 1 0.900 - - E1_COG4286
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 257 1.000 Inparanoid score I993
OMA 1 1.010 - - QHG54164
OrthoDB 1 1.010 - - D1174497at2759
OrthoFinder 1 1.000 - - FOG0004484
OrthoInspector 1 1.000 - - otm2843
orthoMCL 1 0.900 - - OOG6_102232
Panther 1 1.100 - - O PTHR11215
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.