DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11980 and myg1

DIOPT Version :9

Sequence 1:NP_649857.1 Gene:CG11980 / 41078 FlyBaseID:FBgn0037652 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001296417.1 Gene:myg1 / 664752 ZFINID:ZDB-GENE-060312-32 Length:381 Species:Danio rerio


Alignment Length:331 Identity:149/331 - (45%)
Similarity:218/331 - (65%) Gaps:15/331 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IGTHSGTFHCDELVACFMLKQLDEYKNAEIFRSRDNKALKEKCDIIVDVGGVYDHAKKLYDHHQI 92
            ||||:|||||||::|||:|:||.|||:|||.||||...|.| ||::|||||.|||:::.|||||.
Zfish    57 IGTHNGTFHCDEVLACFLLRQLPEYKDAEIVRSRDASVLAE-CDVVVDVGGEYDHSRQRYDHHQR 120

  Fly    93 TFKETFSSVRPDVSEDYNVVRLSSAGLVYCHYGERVIQSI--LQREKGIKLSPENLQTAFIQIYR 155
            .|.|:|.||   .::...|.:||||||||.|||.||:|.:  ||.::     |: |:..:.::|.
Zfish   121 AFAESFHSV---CAQKPWVTKLSSAGLVYVHYGRRVLQQLTHLQEDE-----PQ-LEVLYDKMYE 176

  Fly   156 NFINELDAIDNGVPMFEGVEPIYKISTHLSARIAKLNPSWQETGVDIEDRFRQAMDTAGREFVDN 220
            .|:.|:||:|||:...:| |..|.||:.:|:|::.|||.|.....|.|:.||:|:...|.||.|.
Zfish   177 GFVEEVDAVDNGISQSDG-EQRYTISSTISSRVSYLNPQWNSKEQDTEEGFRKALALVGSEFQDR 240

  Fly   221 VVEVSCSWIPARDHVREALKNAKNVHPTGEILVL-KNFCPWKSHLFDLEKEYKVEGVPKLVVFNS 284
            ::..:.:|:||||.|.:|:|:...|..:|::|:| :..||||.|||.||||.:::.:.|.|::..
Zfish   241 LLYFTNAWLPARDVVLQAIKSRHQVDVSGQVLLLQQGGCPWKEHLFALEKELQLQELIKFVLYCD 305

  Fly   285 GNS-WRVAGVPVTPGSYLGRKFLPTPWRGLMDDELCDKASIKDLEFIHHTGFIGGAKTEEAAMLL 348
            .|. |||..||..|.::..|..|...||||.||.|.:.:.|.:..|:|..|||||.||:..|:.:
Zfish   306 QNGHWRVQCVPAGPNTFQNRLSLLEEWRGLRDDALSELSGIPECIFVHAGGFIGGNKTQSGALEM 370

  Fly   349 AKKSTE 354
            |:::.:
Zfish   371 ARRTLQ 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11980NP_649857.1 UPF0160 28..352 CDD:281655 149/327 (46%)
myg1NP_001296417.1 UPF0160 56..375 CDD:281655 149/328 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576183
Domainoid 1 1.000 285 1.000 Domainoid score I1589
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5853
Inparanoid 1 1.050 285 1.000 Inparanoid score I2831
OMA 1 1.010 - - QHG54164
OrthoDB 1 1.010 - - D1174497at2759
OrthoFinder 1 1.000 - - FOG0004484
OrthoInspector 1 1.000 - - oto38662
orthoMCL 1 0.900 - - OOG6_102232
Panther 1 1.100 - - LDO PTHR11215
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.