DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and AT1G50060

DIOPT Version :10

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_175428.1 Gene:AT1G50060 / 841430 AraportID:AT1G50060 Length:161 Species:Arabidopsis thaliana


Alignment Length:133 Identity:32/133 - (24%)
Similarity:58/133 - (43%) Gaps:24/133 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 NLPRA-VKFKNIKWDDELSVMAMRVSN----QC-LQHTFSPCVNTFLYKDVGESSDFVKVQNTSK 159
            |..|| |...|:.||..|:..|:..||    .| |.|:..|         .||:    ..:.:|.
plant    35 NTARAQVGVPNVVWDTTLAAYALNYSNFRKADCNLVHSNGP---------YGEN----LAKGSSS 86

  Fly   160 GFNVISFLNMWFEYHKMMKPSYVNNFPNIAPQDRLIIFANLIYEKNKKMGCGMVK-SGQGRFLTC 223
            .|:.||.:.:|.:    .||.|...:.|.....:.:.:..:::..:.|:||..|: :....|::|
plant    87 SFSAISAVKLWVD----EKPYYSYAYNNCTGGKQCLHYTQVVWRDSVKIGCARVQCTNTWWFVSC 147

  Fly   224 LFD 226
            .::
plant   148 NYN 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 CAP_euk 81..226 CDD:349399 32/131 (24%)
AT1G50060NP_175428.1 CAP_PR-1 27..161 CDD:349400 32/133 (24%)

Return to query results.
Submit another query.