DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and AT1G50050

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_175427.1 Gene:AT1G50050 / 841429 AraportID:AT1G50050 Length:226 Species:Arabidopsis thaliana


Alignment Length:189 Identity:44/189 - (23%)
Similarity:73/189 - (38%) Gaps:42/189 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 NLPRA-VKFKNIKWDDELSVMAMRVSNQCLQHTFSPCVNTFLYKDVGESSDFVKVQNTSKG---- 160
            |..|| |...|:.||..::..|...:|       :..|:..|....|.|..    :|.:.|    
plant    35 NTARAQVGVANVVWDTVVAAYATNYAN-------ARKVDCSLTPSTGGSYG----ENLANGNNAL 88

  Fly   161 FNVISFLNMWFEYHKMMKPSYVNNFPN--IAPQDRLIIFANLIYEKNKKMGCGMVK-SGQGRFLT 222
            |..::.:|:|..    .|| |.|...|  |..| :...:..:::..:.|:||..|. :..|.|:.
plant    89 FTGVAAVNLWVN----EKP-YYNYTANACIGAQ-QCKHYTQVVWSNSVKIGCARVLCNNGGYFVG 147

  Fly   223 CLFD-----KKIKPNQKLYTTR----------LNDPFRTNRK--TNETESIQSNSSSTE 264
            |.:|     |..|....:..||          |.:.|:.:..  |.|.|.|::...|.:
plant   148 CNYDASAALKSRKITASVRQTRGLGASAACGQLRNKFQKSPSLATAEGEVIEARLRSED 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 32/132 (24%)
AT1G50050NP_175427.1 SCP 27..151 CDD:294090 32/132 (24%)
Radical_SAM <155..185 CDD:302752 5/29 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.