DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11977 and AT1G01310

DIOPT Version :9

Sequence 1:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_171638.2 Gene:AT1G01310 / 839333 AraportID:AT1G01310 Length:241 Species:Arabidopsis thaliana


Alignment Length:213 Identity:49/213 - (23%)
Similarity:71/213 - (33%) Gaps:59/213 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 HITCGFKF-----WSTKCGRNHE---------------------------GVRMS-DYRYDIVRN 87
            ||..|..|     ||.....|||                           |.|.| .:|:..:|.
plant    13 HIFVGITFFLLQLWSGTAQINHEDSSTKPSVKNSPSATSTRLLLSPPSFTGNRFSFRFRWRRIRR 77

  Fly    88 VNNFRRKLEWGL--GNLPRA-VKFKNIKWDDELSVMAMRVSNQ----C-LQHTFSPCVNTFLYKD 144
            .|...|.....|  .||.|| |.....:||..|:..|...:||    | |.|:..|         
plant    78 RNRVNRASREFLIAHNLVRARVGEPPFQWDGRLAAYARTWANQRVGDCRLVHSNGP--------- 133

  Fly   145 VGESSDFVKVQNTSKGFNVISFLNMWFEYHKMMKPSYVNNFPNIAPQDRLIIFANLIYEKNKKMG 209
            .||:..:....|.|..    ..:|:|.:..|.    |........||.....:..:::..:.|:|
plant   134 YGENIFWAGKNNWSPR----DIVNVWADEDKF----YDVKGNTCEPQHMCGHYTQIVWRDSTKVG 190

  Fly   210 CGMVK-SGQGRFLTCLFD 226
            |..|. |..|.:..|:::
plant   191 CASVDCSNGGVYAICVYN 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 37/153 (24%)
AT1G01310NP_171638.2 SCP_PR-1_like 87..219 CDD:240181 33/139 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.